469893
AGGF1 (FLJ10283, GPATC7, GPATCH7, HSU84971, HUS84971, VG5Q) (Not for Export EU)
Size
£685.00
- SKU:
- 469893
- Application:
- WB
- Purity:
- Serum
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-109 from full length human AGGF1.
- Format:
- Supplied as a liquid. No preservative added.
- Extra Details:
- The AGGF1 gene encodes a potent angiogenic factor that contains a forkhead-associated domain and a G-patch domain (Tian et al., 2004 [PubMed 14961121]).[supplied by OMIM] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASEAPSPPRSPPPPTSPEPELAQLRRKVEKLERELR SCKRQVREIEKLLHHTERLYQNAESNNQELRTQVRGP PQPRAPSSPGEAFEARDSLGRGPWQGLRTTVEYLK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice