AFP (FETA, HPAFP)

Size

£685.00

SKU:: 469891
Application:: WB
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-609 from full length human AFP.
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly. [provided by RefSeq] Applications: Suitable for use in Western Blot, Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKWVESIFLIFLLNFTESRTLHRNEYGIASILDSYQCTA EISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPT GDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCS QSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEE DRETFMNKFIYEIARRHPFLYAPTILLWAARYDKIIPSCC KAENAVECFQTKAATVTKELRESSLLNQHACAVMKNF GTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEH CCRGDVLDCLQDGEKIMSYICSQQDTLSNKITECCKLT TLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSS GEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLE KCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLF QKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAAT AATCCQLSEDKLLACGEGAADIIIGHLCIRHEMTPVNPG VGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIF HKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAV IADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice