469887
ADAM2 (CRYN1, CRYN2, FTNB, PH-30b, PH30)
Size
£685.00
- SKU:
- 469887
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-579 from full length human ADAM2.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MWRVLFLLSGLGGLRMDSNFDSLPVQITVPEKIRSIIKE GIESQASYKIVIEGKPYTVNLMQKNFLPHNFRVYSYSG TGIMKPLDQDFQNFCHYQGYIEGYPKSVVMVSTCTGL RGVLQFENVSYGIEPLESSVGFEHVIYQVKHKKADVSL YNEKDIESRDLSFKLQSVEHPRTISLESLAVILAQLLSLS MGITYDDINKCQCSGAVCIMNPEAIHFSGVKIFSNCSFE DFAHFISKQKSQCLHNQPRLDPFFKQQAVCGNAKLEA GEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEGP CCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPE NHYVQTGHPCGLNQWICIDGVCMSGDKQCTDTFGKE VEFGPSECYSHLNSKTDVSGNCGISDSGYTQCEADG HLCIAVEFASDHADSQKMWIKDGTSCGSNKVCRNQR CVSSSYLGYDCTTDKCNDRGVCNNKKHCHCSASYLP PDCSVQSDLWPGGSIDSGNFPPVAIPARLPERRYIENI YHSKPMRWPFFLFIPFFIIFCVLIAIMVKVNFQRKKWRT EDYSSDEQPESESEPKG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice