Tick Anticoagulant Peptide, Recombinant, Ornithodoros Moubata, aa1-60, His-SUMO-tag, Myc-tag (TAP)

Size

£633.00

SKU:: 406051
Molecular Weight:: 27
Purity:: ~85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa. Source: Recombinant protein corresponding to aa1-60 from Ornithodoros Moubata Tick Anticoagulant Peptide, fused to His-SUMO-tag at N-terminal and Myc-tag at C-terminal, expressed in E. coli. Molecular Weight: ~27.0kD Amino Acid Sequence: YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.