Thymic Stromal Lymphopoietin, Recombinant, Human, aa29-159, His-Tag (TSLP)

Size

£576.00

SKU:: 406050
Molecular Weight:: 18.9
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in Tris, 50% glycerol
Extra Details:: Isoform 1: Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c+ dendritic cells. Can induce allergic inflammation by directly activating mast cells. Isoform 2: May act as an antimicrobial peptide in the oral cavity and on the skin. Source: Recombinant protein corresponding to aa29-159 from human Thymic stromal lymphopoietin, fused to His-Tag at N-terminal, expressed in mammalian cell. Molecular Weight: ~18.9kD AA Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.