Matrix Protein, Recombinant, Rabies Virus, aa1-202, His-tag, Myc-tag (M)

Size

£555.00

SKU:: 405986
Molecular Weight:: 28.1
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Plays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bullet-shaped form. Inhibits viral transcription and stimulates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons. Source: Recombinant protein corresponding to aa1-202 from rabies virus Matrix protein, fused to His-tag at N-terminal and Myc-tag at C-terminal, expressed in E. coli. Molecular Weight: ~28.1kD Amino Acid Sequence: MNVLRKIVKKCRDEDTQKPSPVSAPPYDDDLWLPPPEYVPLKELTSKKNMRNFCVNGEVKACSPNGYSFRILRHILGSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVGARQCHIQGRIWCINSNSRACQLWSDMSLQTQRSEEDKDSSLLLE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.