Interleukin-10, Recombinant, Macaca mulatta, aa19-178, His-Tag, Myc-Tag (IL10)

Size

£479.00

SKU:: 405961
Molecular Weight:: 22.7
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in Tris, 50% glycerol
Extra Details:: Recombinant protein corresponding to aa19-178 from Macaca mulatta Interleukin-10, fused to 10xHis-Tag at N terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~22.7kD Amino Acid Sequence: SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.