Gamma-hemolysin Component B, Recombinant, Staphylococcus Aureus, aa26-325, His-tag (hlgB)

Size

£570.00

SKU:: 405928
Molecular Weight:: 36.1
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in Tris, 50% glycerol.
Extra Details:: Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity. Source: Recombinant protein corresponding to aa26-325 from staphylococcus aureus gamma-hemolysin component B, fused to His-tag at N-terminal, expressed in yeast. Molecular Weight: ~36.1kD Amino Acid Sequence: AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.