Claudin-3, Recombinant, Human, aa30-80, His-B2M-tag (CLDN3)

Size

£518.00

SKU:: 405892
Molecular Weight:: 19.7
Purity:: ~90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Source: Recombinant protein corresponding to aa30-80 from human Claudin-3, fused to His-B2M-tag at N-terminal, expressed in E. coli. Molecular Weight: ~19.7kD AA Sequence: RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.