Acidic Protein MsyB, Recombinant, E. coli, aa1-124, His-tag (msyB)

Size

£657.00

SKU:: 405859
Molecular Weight:: 16.3
Purity:: ~85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 10% glycerol.
Extra Details:: Could participate in the normal pathway of protein export. Source: Full-length recombinant protein corresponding to aa1-124 from E. coli Acidic Protein MsyB, fused to His-tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~16.3kD Amino Acid Sequence: MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.