Ataxin 1 (Ataxin-1, ATX1, Atxn1, SCA1, Spinocerebellar Ataxia Type 1 Protein)

Size

£626.00

SKU:: 384909
Purity:: Purified by Protein G affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Synthetic peptide corresponding to aa164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin 1.
Clone:: S76-8
Format:: Supplied as a liquid in PBS, pH 7.4, 0.09% sodium azide, 50% glycerol.
Extra Details:: Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons. Applications: Suitable for use in Western Blot, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunoprecipitation. Other applications not tested. Recommended Dilution: Western Blot: 1:1000 Immunocytochemistry/Immunofluorescence: 1:100 Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice