377486
LOX-1 (OLR1)
Size
£620.00
- SKU:
- 377486
- Application:
- WB
- Purity:
- Purified by immunoaffinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa162-197, SFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISY from human LOX-1/OLR1, different from the related rat sequence by 13aa.
- Format:
- Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
- Extra Details:
- OLR1(oxidized low density lipoprotein (lectin-like) receptor 1) also called CLEC8A, LOX-1, SCARE1, is a receptor protein which belongs to the C-type lectin superfamily. The OLR1 gene encodes a cell-surface endocytosis receptor for oxidized low density lipoprotein (OxLDL). This gene is mapped on 12p13.2. Incubation of the cells with LDL had no effect on LOX1 expression, but incubation with OxLDL resulted in a dose-dependent increase in LOX1 mRNA and protein expression; however, very high concentrations of OxLDL caused a decrease in OxLDL expression, perhaps indicating toxic effects on endothelial cells. LOX1 was also expressed in macrophages, but not in vascular smooth muscle cells. The findings suggested a role for LOX1 in the pathophysiology of atherosclerotic cardiovascular disease. LOX1 expression was detected in all choroidal neovascular membranes, regardless of structure, whereas there was no evidence of LOX1 within the posterior segments of normal eyes. LOX1 plays an active role in the pathogenesis of choroidal neovascularization, especially in ARMD. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice