377429
IL1 beta
Size
£620.00
- SKU:
- 377429
- Application:
- WB
- Purity:
- Purified by immunoaffinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to DPKQYPKKKMEKRFVFNKIEVKSKVEFESAE from mouse IL1 beta.
- Format:
- Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
- Extra Details:
- Interleukin-1 beta (IL-1beta) also know as catabolin, is a cytokine protein that in humans is encoded by the IL1B gene, which localizes to the long arm of chromosome 2 at position 2q13-2q21 between two fragile sites. Interleukin 1 (IL-1) is a protein with several biological activities regulating host defense and immune responses. The human IL-1 family plays an important role in the pathogenesis of many diseases and functions as a key mediator of the host response to various infectious, inflammatory, and immunologic challenges. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice