377275
CD105
Size
£620.00
- SKU:
- 377275
- Application:
- WB
- Purity:
- Purified by immunoaffinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa258-297, YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ from human CD105, different from the related mouse sequence by 12aa.
- Format:
- Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
- Extra Details:
- Endoglin (Osler-Rendu-Weber syndrome 1), CD105, is a type I membrane glycoprotein located on cell surfaces and is a part of the TGF beta receptor complex. Its gene is mapped to human chromosome 8. The protein consists of a homodimer of 180kD with disulfide links. It has been found on endothelial cells, activated macrophages, fibroblasts and smooth muscle cells. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling and has been found to be elevated in pregnant women who subsequently develop preeclampsia. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice