377235
ANX4 (Annexin IV)
Size
£620.00
- SKU:
- 377235
- Application:
- WB
- Purity:
- Purified by immunoaffinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide corresponding to aa119-152, EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL from human ANX4, different from the related mouse and rat sequences by 3aa.
- Format:
- Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O.
- Extra Details:
- ANXA4 (Annexin A4), also known as ANX4, is a protein that in humans is encoded by the ANXA4 gene. It belongs to the annexin family of calcium-dependent phospholipid binding proteins. By PCR analysis of somatic cell hybrids and in situ hybridization with a cDNA probe, the human ANXA4 gene is mapped to chromosome 2p13. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. And ANXA4 is almost exclusively expressed in epithelial cells. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-0.5ug/ml Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
- Shipping Conditions:
- Blue Ice