VSTM1 (UNQ3033, V-set And Transmembrane Domain Containing 1)

Size

£685.00

SKU:: 377194
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-174 from full length human VSTM1, fused to GST-Tag. MW of the GST tag alone is ~26kD.
Clone:: 2E12
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Isoform 2: Behaves as a cytokine, promoting IL17A secretion by CD4+ T-cells, and differentiation and activation of IL17 producing helper T-cells (TH17). Isoform 1: Inhibitory immune receptor involved in the regulation of phagocytes. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSS VVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQS SAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESS EHLQLVVTDKHDELEAPSMKTDTRTIFVAIFSCISILLLF LSVFIIYRCSQHSELRERKGREGE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.