TNFRSF21 (BM-018, DR6, Tumor Necrosis Factor Receptor Superfamily, Member 21)

Size

£685.00

SKU:: 377191
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protien corresponding to aa373-655 from partial human TNFRSF21, fused to GST-Tag.
Clone:: 8A6
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB and MAPK8/JNK, and induce cell apoptosis. Through its death domain, this receptor interacts with TRADD protein, which is known to serve as an adaptor that mediates signal transduction of TNF-receptors. Knockout studies in mice suggested that this gene plays a role in T-helper cell activation, and may be involved in inflammation and immune regulation. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: SSRTLKKGPRQDPSAIVEKAGLKKSMTPTQNREKWIY YCNGHGIDILKLVAAQVGSQWKDIYQFLCNASEREVAA FSNGYTADHERAYAALQHWTIRGPEASLAQLISALRQ HRRNDVVEKIRGLMEDTTQLETDKLALPMSPSPLSPS PIPSPNAKLENSALLTVEPSPQDKNKGFFVDESEPLLR CDSTSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDL QPIFDDMLHFLNPEELRVIEEIPQAEDKLDRLFEIIGVKS QEASQTLLDSVYSHLPDLL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice