TNFRSF13B (CD267, CVID, TACI, TNFRSF14B, Tumor Necrosis Factor Receptor Superfamily, Member 13B)

Size

£685.00

SKU:: 377184
Purity:: Purified
Storage Conditions:: 0°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa2-165 from partial human TNFRSF13B, fused to GST-Tag.
Clone:: 1E12
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPE EQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCR KEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLR SPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSE ASPALPGLKLSADQVALVYS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.