LENG1 (Leukocyte Receptor Cluster (LRC) Member 1)

Size

£685.00

SKU:: 377163
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-264 from human LENG1. MW of the GST-Tag alone is ~26kD.
Clone:: 2E7
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Belongs to the leukocyte receptor cluster (LRC) present on 19q13.4. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: MNILPKKSWHVRNKDNVARVRRDEAQAREEEKERER RVLLAQQEARTEFLRKKARHQNSLPELEAAEAGAPGS GPVDLFRELLEEGKGVIRGNKEYEEEKRQEKERQEKA LGILTYLGQSAAEAQTQPPWYQLPPGRGGPPPGPAP DEKIKSRLDPLREMQKHLGKKRQHGGDEGSRSRKEK EGSEKQRPKEPPSLDQLRAERLRREAAERSRAEALLA RVQGRALQEGQPEEDETDDRRRRYNSQFNPQLARRP RQQDPHLTH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.