HSFX1 (LW-1, Heat Shock Transcription Factor Family, X Linked 1)

Size

£685.00

SKU:: 377157
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-423 from human HSFX1. MW of the GST-Tag alone is ~26kD.
Clone:: 3E19
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Located on chromosome X, this gene encodes hypothetical protein LOC51402. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: MEDKRSLSMARCEERNSRGQDHGLERVPFPPQLQSE TYLHPADPSPAWDDPGSTGSPNLRLLTEEIAFQPLAEE ASFRRPHPDGDVPPQGEDNLLSLPFPQKLWRLVSSN QFSSIWWDDSGACRVINQKLFEKEILKRDVAHKVFATT SIKSFFRQLNLYGFRKRRQCTFRTFTRIFSAKRLVSILN KLEFYCHPYFQRDSPHLLVRMKRRVGVKSAPRHQEE DKPEAAGSCLAPADTEQQDHTSPNENDQVTPQHREP AGPNTQIRSGSAPPATPVMVPDSAVASDNSPVTQPAG EWSEGSQAHVTPVAAVPGPAALPFLYVPGSPTQMNS YGPVVALPTASRSTLAMDTTGLPAPGMLPFCHLWVPV TLVAAGAAQPAASMVMFPHLPALHHHCPHSHRTSQY MPASDGPQAYPDYADQST Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.