CD320 (8D6, 8D6A, CD320 Molecule)

Size

£685.00

SKU:: 377141
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-282 from human CD320. MW of the GST-Tag alone is ~26kD.
Clone:: 4F2
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Receptor for transcobalamin saturated with cobalamin (TCbl) (PubMed:18779389). Plays an important role in cobalamin uptake (PubMed:18779389, PubMed:20524213). Plasma membrane protein that is expressed on follicular dendritic cells (FDC) and mediates interaction with germinal center B cells (PubMed:10727470). Functions as costimulator to promote B cell responses to antigenic stimuli; promotes B cell differentiation and proliferation (PubMed:10727470, PubMed:11418631). Germinal center-B (GC-B) cells differentiate into memory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC) (PubMed:11418631). CD320 augments the proliferation of PC precursors generated by IL-10 (PubMed:11418631). Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAAS PLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWR CDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCP CTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCI PLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMG PPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSA GDQSGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQE RLRPLGLLVAMKESLLLSEQKTSLP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice