CD276 (B7-H3, B7H3, CD276 Molecule)

Size

£685.00

SKU:: 377136
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa237-461 from partial human CD276, fused to GST-Tag.
Clone:: 4E9
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Costimulatory B7 molecules (e.g., B7-1, or CD80; MIM 112203) signal through CD28 (MIM 186760) family molecules such as CD28, CTLA4 (MIM 123890), and ICOS (MIM 604558). Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: ITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEP GFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRT ALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGS AAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYR GYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDV HSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP MT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.