CCNJL (Cyclin J-Like)

Size

£685.00

SKU:: 377130
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-121 from human CCNJL. MW of the GST-Tag alone is ~26kD.
Clone:: 4E10
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: CCNJL (Cyclin J Like) is a Protein Coding gene. An important paralog of this gene is CCNJ. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Sequence: MVPGTPPTPTQVLFQPPAYPALGQPATTLAQFQTPVQ DLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQPL DMCPVPVPASLSMHMAIAAEPRHCLATTYGSSYFSGS HMFPTGCFDR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.