Sso7d, Recombinant, Sulfolobus Solfataricus, aa2-64, His-SUMO-Tag (DNA-binding Protein 7d)

Size

£633.00

SKU:: 375421
Molecular Weight:: 23.1
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Constrain negative DNA supercoils; may be involved in maintaining the integrity of their genome at high temperature. Stimulates the Holliday junction cleavage activity of Hjc. Source: Recombinant protein corresponding to aa2-64 from sulfolobus solfataricus DNA-binding Protein 7d, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.1kD Amino Acid Sequence: ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.