SPA17, Recombinant, Human, aa1-146, GST-Tag (Sperm Surface Protein Sp17)

Size

£359.00

SKU:: 375377
Molecular Weight:: 43.8
Purity:: ~90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA and 50% glycerol.
Extra Details:: Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates. Recombinant protein corresponding to aa1-146 from human SPA17, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.8kD Amino Acid Sequence: MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.