Somatoliberin, Recombinant, Sheep, aa1-44, GST-Tag (GHRH)

Size

£633.00

SKU:: 375371
Molecular Weight:: 32.1
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone. Source: Recombinant protein corresponding to a1-44 from sheep Somatoliberin. fused to GST-Tag at N-terminal. expressed in E. coli. Molecular Weight: ~32.1kD Amino Acid Sequence: YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.