SLC34A2, Recombinant, Human, aa574-689, His-Tag (Sodium-dependent Phosphate Transport Protein 2B)

Size

£448.00

SKU:: 375321
Molecular Weight:: 15.1
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in Tris-HCl, pH 8.0, 0.5M sodium chloride, 50% glycerol.
Extra Details:: May be involved in actively transporting phosphate into cells via Na+ cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli. Partial recombinant protein corresponding to aa574-689 from human SLC34A2, fused to 6X His-Tag at N-terminal, expressed in Yeast. Swiss/Uniprot Accession: O95436 Molecular Weight: ~15.1kD Amino Acid Sequence: LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.