RYR3, Recombinant, Human, aa3934-4181, His-Tag (Ryanodine Receptor 3)

Size

£486.00

SKU:: 375171
Molecular Weight:: 32.5
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.
Extra Details:: Calcium channel that mediates the release of Ca2+ from the sarcoplasmic reticulum into the cytoplasm in muscle and thereby plays a role in triggering muscle contraction. May regulate Ca2+ release by other calcium channels. Calcium channel that mediates Ca2+-induced Ca2+ release from the endoplasmic reticulum in non-muscle cells. Contributes to cellular calcium ion homeostasis. Plays a role in cellular calcium signaling. Source: Partial recombinant protein corresponding to aa3934-4181 from human RYR3, fused to 6X His-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: Q15413. Molecular Weight: ~32.5kD Amino Acid Sequence: DGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEADENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYVLEIAGEEEEDGSLEPASAFAMACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAKELV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.