PTDSS1, Recombinant, Human, aa1-35, GST-Tag (Phosphatidylserine Synthase 1)

Size

£486.00

SKU:: 374920
Molecular Weight:: 31.1
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. In membranes, PTDSS1 catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine. Source: Recombinant protein corresponding to aa1-35 from human PTDSS1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.1kD Amino Acid Sequence: MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITID Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.