PSAP, Recombinant, Guinea pig, aa1-81, HIs-Tag (Saposin-C)

Size

£570.00

SKU:: 374895
Molecular Weight:: 10.85
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate. Source: Recombinant protein corresponding to aa1-81 from guinea pig Saposin-C, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.85kD Amino Acid Sequence: ESVTCKACEYVVKKVMELIDNNRTEEKIIHALDSVCALLPESVSEVCQEVVDTYGDSIVALLLQEMSPELVCSELGLCMSG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.