PRKRIR, Recombinant, Human, aa612-761, His-SUMO-Tag (52kD Repressor of The Inhibitor of the Protein Kinase)

Size

£486.00

SKU:: 374853
Molecular Weight:: 33.6
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Upstream regulator of interferon-induced serine/threonine protein kinase R (PKR). May block the PKR-inhibitory function of P58IPK, resulting in restoration of kinase activity and suppression of cell growth. Source: Recombinant protein corresponding to aa612-761 from human PRKRIR, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.6kD Amino Acid Sequence: MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.