Prgj, Recombinant, Salmonella Typhimurium, aa1-101, His-Tag (Protein PrgJ)

Size

£570.00

SKU:: 374847
Molecular Weight:: 12.9
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 50% glycerol.
Extra Details:: Required for invasion of epithelial cells. Full-length recombinant protein corresponding to aa1-101 from Salmonella typhimurium PrgJ, fused to His-Tag at N-terminal and Myc Tag at the C-Terminal, expressed in Yeast. Accession/Uniprot: P41785. Molecular Weight: ~12.9kD Amino Acid Sequence: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.