OCM, Recombinant, Mouse, aa2-109, His-Tag (Oncomodulin)

Size

£557.00

SKU:: 374526
Molecular Weight:: 14.1
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 50% glycerol
Extra Details:: Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions. Recombinant protein corresponding to aa2-109 from mouse Oncomodulin, fused to an N-terminal 6X His-Tag, expressed in Yeast (P51879) Amino Acid Sequence: SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.