LY6G6D, Recombinant, Human, aa20-104, His-Tag (Lymphocyte Antigen 6 Complex Locus Protein G6d)

Size

£448.00

SKU:: 374098
Molecular Weight:: 12
Purity:: ~85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 50% glycerol.
Extra Details:: Source: Recombinant protein corresponding to aa20-104 from human LY6G6D, fused to 6x His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12kD AA Sequence: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.