IL18BP, Recombinant, Mouse, aa29-193, His-Tag (Interleukin-18-binding Protein)

Size

£555.00

SKU:: 373798
Molecular Weight:: 22.1
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response. Source: Recombinant protein corresponding to aa29-193 from mouse IL18BP, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.1kD Amino Acid Sequence: TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.