Ice-structuring Protein Lambda OP-3, Recombinant, Zoarces americanus, aa23-91, His-Tag (ISP lambda OP-3)

Size

£633.00

SKU:: 373723
Molecular Weight:: 11.6
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Contributes to protect fish blood from freezing at subzero sea water temperatures. Lowers the blood freezing point. Binds to nascent ice crystals and prevents further growth (By similarity). Source: Recombinant protein corresponding to aa23-91 from zoarces americanus Ice-structuring protein lambda OP-3, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.6kD Amino Acid Sequence: NQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.