GLRX, Recombinant, Human, aa1-106, GST-Tag (Glutaredoxin-1)

Size

£486.00

SKU:: 373455
Molecular Weight:: 38.8
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in Tris-HCl, pH 8.0, 0.5M sodium chloride, 50% glycerol.
Extra Details:: Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins. Full length recombinant protein corresponding to aa1-106 from human GLRX, fused to GST-Tag at N-terminal, expressed in E. coli. Uniprot/Accession: P35754 Molecular Weight: ~38.8kD Amino Acid Sequence: MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.