GABARAPL1, Recombinant, Human, aa1-117, GST-Tag (Gamma-aminobutyric Acid Receptor-associated Protein-like 1)

Size

£486.00

SKU:: 373380
Molecular Weight:: 40.9
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in PBS, 50% glycerol.
Extra Details:: Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Source: Recombinant protein corresponding to aa1-117 from human GABARAPL1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.9kD Amino Acid Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.