Defb4, Recombinant, Mouse, aa23-63, His-SUMO-Tag (Beta-defensin 4)

Size

£555.00

SKU:: 373031
Molecular Weight:: 20.6
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 50% glycerol.
Extra Details:: Has bactericidal activity. Recombinant protein corresponding to aa23-63 from mouse Defb4, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: P82019 . Molecular Weight: ~20.6kD Amino Acid Sequence: QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.