D-dopachrome Decarboxylase, Recombinant, Mouse, aa2-118, His-Tag (Ddt)

Size

£555.00

SKU:: 372976
Molecular Weight:: 16.9
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI). Source: Recombinant protein corresponding to aa2-118 from mouse D-dopachrome Decarboxylase, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.9kD Amino Acid Sequence: PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.