CXCL10, Recombinant, Human, aa22-98, His-Tag (C-X-C Motif Chemokine 10)

Size

£448.00

SKU:: 372921
Molecular Weight:: 10.65
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. Source: Recombinant protein corresponding to aa22-98 from human CXCL10, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.65kD Amino Acid Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.