Cxcl1, Recombinant, Mouse, aa29-96, His-Tag (Growth-regulated alpha Protein)

Size

£555.00

SKU:: 372919
Molecular Weight:: 11.5
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hematopoietic activity. Source: Recombinant protein corresponding to aa29-96 from mouse Growth-regulated alpha Protein, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.5kD Amino Acid Sequence: NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.