CMA1, Recombinant, Human, aa22-247, His-Tag (Chymase)

Size

£555.00

SKU:: 372799
Molecular Weight:: 29
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from 10mM Tris,-HCl, 1mM EDTA, 6% Trehalose, pH8.0. Reconstitute with sterile ddH2O to 0.1-1mg/ml.
Extra Details:: Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular domain matrix degradation, and regulation of gland secretion. Recombinant protein corresponding to aa22-247 from human CMA1, fused to 6xHis-B2M tagged N-terminal, expressed in E. coli. Swiss/UniProt Accession: P23946.. Molecular Weight: ~29.0kD Amino Acid Sequence: IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.