F1 Capsule Antigen, Recombinant, Yersinia Pestis, aa22-170, His-Tag (Caf1)

Size

£570.00

SKU:: 372536
Molecular Weight:: 17.6
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: Full length recombinant protein corresponding to aa22-170 from yersinia pestis F1 Capsule Antigen, fused to 6X His-Tag at N-terminal, expressed in Yeast. Swiss/Uniprot Accession: P26948 Molecular Weight: ~17.6kD Amino Acid Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.