Outer Membrane Protein C, Recombinant, Escherichia coli, aa22-367, His-SUMO-Tag (OmpC)

Size

£633.00

SKU:: 370730
Molecular Weight:: 54.28
Purity:: ≥95% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.
Extra Details:: Forms pores that allow passive diffusion of small molecules across the outer membrane. Recombinant protein corresponding to aa22-367 from Escherichia coli Outer Membrane Protein C, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~54.28kD Amino Acid Sequence: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.