Invasin, Recombinant, Yersinia Enterocolitica, aa651-835, His-Sumo-Tag

Size

£416.00

SKU:: 370670
Molecular Weight:: 36.3
Purity:: ≥85% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.
Extra Details:: Invasin is a protein that allows enteric bacteria to penetrate cultured mammalian cells. The entry of invasin in the cell is mediated by binding several beta-1 chain integrins. Partal recombinant protein corresponding to aa651-835 from Yersinia enterocolitica Invasin, fused to 6x His-SUMO Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: P19196. Molecular Weight: ~36.3kD Amino Acid Sequence: VNGEQFATDKGFPKTTFNKATFQLVMNDDVANNTQYDWTSSYAASAPVDNQGKVNIAYKTYGSTVTVTAKSKKFPSYTATYQFKPNLWVFSGTMSLQSSVEASRNCQRTDFTALIESARASNGSRSPDGTLWGEWGSLATYDSAEWPSGNYWTKKTSTDFVTMDMTTGDIPTSAATAYPLCAEPQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.