Glp1r, Recombinant, Mouse, aa22-145, His-SUMO-Tag (Glucagon-like Peptide 1 Receptor)

Size

£555.00

SKU:: 370628
Molecular Weight:: 30.4
Purity:: ≥90% (SDS-PAGE)
Storage Conditions:: -20°C
Supplier:: United States Biological
Format:: Supplied as a lyophilized powder. Reconstitute with ddH2O to a concentration of 0.1-1mg/ml.
Extra Details:: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Partial recombinant protein corresponding to aa22-145 from mouse Glp1r, fused to 6x His-SUMO-Tag at N-terminal, expressed in E. coli. Unprot/Accession: O35659 Molecular Weight: ~30.4kD Amino Acid Sequence: GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.