ZNF673 (Protein ZNF673)

Size

£685.00

SKU:: 368496
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: ZNF673 (AAH12569.1, aa1-98) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7D3
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: ZNF673 belongs to the krueppel C2H2-type zinc-finger protein family. ZNF673 may be involved in transcriptional regulation. Defects in ZNF673 may be the cause of mental retardation X-linked type 92 (MRX92). Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGYLVAKPDVIFRLGPGEESWMADGGPVRTCAGEDRPDVSIFASCILKCCY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.