ZNF428 (C19orf37, Zfp428, Zinc Finger Protein 428, Enzyme-like Protein PIT13)

Size

£685.00

SKU:: 368494
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: ZNF428 (NP_872304.2, aa1-188) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3H4
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: ZNF428 contains 1 C2H2-type zinc finger. The exact function of ZNF428 remains unknown. Two different isoforms have been described. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTETREPAETGGYASLEEDDEDLSPGPEHSSDSEYTLSEPDSEEEEDEEEEEEETTDDPEYDPGYKVKQRLGGGRGGPSRRAPRAAQPPAQPCQLCGRSPLGEAPPGTPPCRLCCPATAPQEAPAPEGRALGEEEEEPPRAGEGRPAGREEEEEEEEEGTYHCTECEDSFDNLGELHGHFMLHARGEV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.