SPPL2A (Signal Peptide Peptidase-like 2A, SPP-like 2A, SPPL2a, Intramembrane Protease 3, IMP-3, Presenilin-like Protein 2, IMP3, PSL2)

Size

£685.00

SKU:: 368347
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: SPPL2A (NP_116191.2, aa31-129) partial recombinant protein with GST tag.
Clone:: 1C7
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene is a member of the signal peptide peptidase-like protease (SPPL) family and encodes an endosomal membrane protein with a protease associated (PA) domain. This protein plays a role in innate and adaptive immunity. A pseudogene of this gene also lies on chromosome 15. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLEKARIAQKGGAEAMLVVNNSVLFPPSGNRSE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.